PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D04G1173
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 356aa    MW: 41028.8 Da    PI: 10.0519
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D04G1173genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.25.7e-16453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW +eEd ll  +vkq+G++ W++++++m+  ++R +k+c +rw++yl
      Gh_D04G1173  4 RQRWRAEEDALLCAYVKQYGPREWNLVSHRMNtpLNRDAKSCLERWNNYL 53
                     89***********************************************7 PP

2Myb_DNA-binding36.41.2e-1159103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
      Gh_D04G1173  59 KGSLTEEEQRLVIRLQAKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103
                      6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.412153IPR017930Myb domain
SMARTSM007172.0E-13355IPR001005SANT/Myb domain
SuperFamilySSF466892.68E-21498IPR009057Homeodomain-like
PfamPF002493.7E-13453IPR001005SANT/Myb domain
CDDcd001672.11E-8653No hitNo description
Gene3DG3DSA:1.10.10.609.5E-21660IPR009057Homeodomain-like
PROSITE profilePS5129423.33854108IPR017930Myb domain
SMARTSM007172.8E-1058106IPR001005SANT/Myb domain
PfamPF002493.5E-1059100IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-1561102IPR009057Homeodomain-like
CDDcd001672.96E-763104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MKERQRWRAE EDALLCAYVK QYGPREWNLV SHRMNTPLNR DAKSCLERWN NYLKPGIKKG  60
SLTEEEQRLV IRLQAKHGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQQRE HKEKHKTVEP  120
VEEGKYDRIL ETFAEKLVKQ GHSSAFPMAA SNGGFLHTDP PSPAPPTLLP PWLSNSSNAS  180
VVTPPSPSVT LSLSPSTVAA APPIPWLQPE RMSETSPVLG NRVPHGSFPR SENLLISELM  240
DCCRQLEDGR RAWVAHRKEA AWRLRRVELQ LESEKASRKR KKMEEIESKI EALREEQKST  300
LDRIEAEYRE QLEGLRRDAE AKEQKLAEQW AAKHLHLTKF LEQTGCRPRV VEPNGQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C6e-16792789C-Myb DNA-Binding Domain
1mse_C6e-16792789C-Myb DNA-Binding Domain
1gv2_A7e-16792789MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1277281RKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.104020.0boll| leaf| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012459483.10.0PREDICTED: transcription factor AS1
RefseqXP_012459482.10.0PREDICTED: transcription factor AS1
SwissprotO809311e-162AS1_ARATH; Transcription factor AS1
TrEMBLA0A0B0PHF60.0A0A0B0PHF6_G
TrEMBLA0A0D2V3W90.0A0A0D2V3W9_G
STRINGPOPTR_0006s08610.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61862740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.11e-134MYB family protein